PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.4G007800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 350aa    MW: 37156 Da    PI: 6.5086
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.4G007800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.91.2e-181562148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd+llvd++k+ G g+W++ ++  g++R++k+c++rw +yl
  Sevir.4G007800.1.p 15 KGPWTPEEDKLLVDYIKENGHGSWRRLPKLAGLNRCGKSCRLRWTNYL 62
                        79********************************************97 PP

2Myb_DNA-binding58.31.7e-1868113148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rgr+T eE++l+++++  lG++ W++Ia +++ gRt++++k++w+++l
  Sevir.4G007800.1.p  68 RGRFTDEEEKLIIHLHSILGNK-WSSIATKLP-GRTDNEIKNYWNTHL 113
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.611062IPR017930Myb domain
SuperFamilySSF466899.17E-3112109IPR009057Homeodomain-like
SMARTSM007175.0E-151464IPR001005SANT/Myb domain
PfamPF002494.9E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-241669IPR009057Homeodomain-like
CDDcd001675.29E-121762No hitNo description
PROSITE profilePS5129428.06363117IPR017930Myb domain
SMARTSM007174.0E-1767115IPR001005SANT/Myb domain
PfamPF002491.4E-1668113IPR001005SANT/Myb domain
CDDcd001672.51E-1370113No hitNo description
Gene3DG3DSA:1.10.10.607.5E-2770117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGRSPCCDQD AGVKKGPWTP EEDKLLVDYI KENGHGSWRR LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGR FTDEEEKLII HLHSILGNKW SSIATKLPGR TDNEIKNYWN THLRKKLLSM  120
GIDPVTHRPR TDLNLLAGIP NLLAAGIPNL AAAAQTTWDI NALRLQADAA KYQLLQGLLR  180
AFAAPPAAPT GVDLMALLAA TGNGGVSQPA AGVDHGTTTR AHQYDGLLNL PALTTVPAAT  240
LPAMSSFSGL LSSFGGALAG DGLSSTTELG HSGASGSSMT AAMAPPLVAA EECNAGGGGM  300
STPCGEETPA SSPFEGLGNL NLDDEFNSDS WRDLLEQMSW LNNPNEQQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30151177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7276651e-153KJ727665.1 Zea mays clone pUT5592 MYB transcription factor (MYB148) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964317.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP02e-78MYB39_ARATH; Transcription factor MYB39
TrEMBLK3XXY20.0K3XXY2_SETIT; Uncharacterized protein
STRINGSi006790m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55293158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.22e-79myb domain protein 9